PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2881_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 703aa    MW: 79082.1 Da    PI: 7.7657
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2881_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP114.65.5e-36100176177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +Cqv+gCe+d+ e+k yh+rh+vC ++++a++v+++g+ +r+CqqC++fh l +fDe+krsCrr+L++hn+rr++k 
  RrC2881_p1 100 RCQVPGCEVDIRELKGYHKRHRVCLTCANASSVVLDGEDKRYCQQCGKFHVLPDFDEGKRSCRRKLERHNNRRKRKD 176
                 6************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.3E-2894162IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.16298175IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-3399177IPR004333Transcription factor, SBP-box
PfamPF031102.5E-27101174IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    Send to blast
MWDWGDLLDF AADDTLLFSP APPPPPMIAT QQPPTQSESY PSPDESGSGS DRVRKRDPRL  60
LCSNFVQGMV PCSCPELDQK LEEAELPKRK RVRGGSGVVR CQVPGCEVDI RELKGYHKRH  120
RVCLTCANAS SVVLDGEDKR YCQQCGKFHV LPDFDEGKRS CRRKLERHNN RRKRKDKGGV  180
ASKEQQVLSQ NDNSVIDVDD GKDNTCSSDQ RVEQEASLIC EDWNIPTQGS VPFPRSINAD  240
NFVPVTGSGE AQPDEGMNDT KFELSPSRGD NKSAYSTVCP TGRISFKLYD WNPAEFPRRL  300
RHQIFQWLAN MPVELEGYVR PGCGTTLKRV DVKLESPKLQ FVYPTCFEAG KPIELMVCGL  360
NLVQPKCRFL VSFAGKYLPH NYSVVPAPDQ NGKRSCNNKL YRINIVNSDP NLFGPAFVEV  420
ENESGLSNFI PLIIGDKAIC SEMKLIEQKF NAALFPEEQY VTACCCSLTC RCRDFKERQN  480
TFTGLLLDIA WSVKVPSAEC TELTVNRCQI KRYNRVLDYL KQSNSPSILG NILHNLEILV  540
KKMEPDSLIH SKCDCDVRLL HENMNLARKQ QSHEDSKLDP VTSSCCCESS FQKDIPSRTL  600
NFNQDPEAGL DCKERVQATS LDAGGKETDP LLNKEVVMNV NDIGNWPRKS CISRHTAQTF  660
RSRQTALLIT TFVVCFAVCA VIYHPNKVRQ LSVAIRARLA HKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-4398181388squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170175RRKRKD
2171176RKRKDK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613694.10.0PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLA0A078EKQ80.0A0A078EKQ8_BRANA; BnaC02g08350D protein
STRINGBra023695.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63582644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7